![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (19 species) not a true protein |
![]() | Species Hypomesus nipponensis [TaxId:182223] [370484] (2 PDB entries) |
![]() | Domain d6jk5a_: 6jk5 A: [370499] automated match to d2afpa_ complexed with so4 |
PDB Entry: 6jk5 (more details), 1.25 Å
SCOPe Domain Sequences for d6jk5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jk5a_ d.169.1.0 (A:) automated matches {Hypomesus nipponensis [TaxId: 182223]} cptdwklfdgtcylfnpsvlhwadaqescmkegaslasihsleqytfvkelttaaltpsw lgggdcqvstrwfwmdgtsmdftdwcyaqpdttltecciqmnvgvgkcwddtpcthlhss icakt
Timeline for d6jk5a_: