![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
![]() | Protein automated matches [276200] (4 species) not a true protein |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [370435] (5 PDB entries) |
![]() | Domain d6jo58_: 6jo5 8: [370496] Other proteins in same PDB: d6jo5a_, d6jo5b_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5f_, d6jo5j_ automated match to d4xk88_ complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4 |
PDB Entry: 6jo5 (more details), 2.9 Å
SCOPe Domain Sequences for d6jo58_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jo58_ f.43.1.0 (8:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} rqswlpgsqipahldtpaaqalagnfgfdplglgkdpvalrwyqqaelihcrtamagvag ilipglltkagalnvpewydagkvaiensfapwgsllavqlflcgfveakrwqdirkpgs qgepgsflgfeaslkgtselgypggpfdplglskeadkwadwklkevkngrlamlaflgf vaqkyatgagpvdnlaahlkdpwhvnyatngvslpfl
Timeline for d6jo58_: