Lineage for d6jo5f_ (6jo5 F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631476Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 2631500Family f.23.16.0: automated matches [276195] (1 protein)
    not a true family
  6. 2631501Protein automated matches [276199] (4 species)
    not a true protein
  7. 2631504Species Chlamydomonas reinhardtii [TaxId:3055] [370452] (4 PDB entries)
  8. 2631508Domain d6jo5f_: 6jo5 F: [370488]
    Other proteins in same PDB: d6jo51_, d6jo53_, d6jo54_, d6jo57_, d6jo58_, d6jo59_, d6jo5a_, d6jo5b_, d6jo5c_, d6jo5d_, d6jo5e_, d6jo5j_, d6jo5z_
    automated match to d5l8rf_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo5f_

PDB Entry: 6jo5 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (F:) Photosystem I reaction center subunit F, Photosystem I reaction center subunit III, chloroplastic

SCOPe Domain Sequences for d6jo5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo5f_ f.23.16.0 (F:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
diagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyakag
llcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakptd
keiiidvplatklawqgagwplaavqelqrgtllekeenitvspr

SCOPe Domain Coordinates for d6jo5f_:

Click to download the PDB-style file with coordinates for d6jo5f_.
(The format of our PDB-style files is described here.)

Timeline for d6jo5f_: