Lineage for d6jo5d_ (6jo5 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611464Species Chlamydomonas reinhardtii [TaxId:3055] [370481] (4 PDB entries)
  8. 2611468Domain d6jo5d_: 6jo5 D: [370482]
    Other proteins in same PDB: d6jo51_, d6jo53_, d6jo54_, d6jo57_, d6jo58_, d6jo59_, d6jo5a_, d6jo5b_, d6jo5c_, d6jo5e_, d6jo5f_, d6jo5j_, d6jo5z_
    automated match to d5l8rd_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo5d_

PDB Entry: 6jo5 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (D:) photosystem I reaction center subunit II, chloroplastic

SCOPe Domain Sequences for d6jo5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo5d_ d.187.1.1 (D:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
wtvptlnpdtpspifggstggllrkaqteefyvitweakkeqifemptggaaimrqgpnl
lkfgkkeqclalttqlrnkfkltpcfyrvfpdgkvqylhpadgvypekvnagrvganqnm
rrigqnvnpikvkfsgrmmspaei

SCOPe Domain Coordinates for d6jo5d_:

Click to download the PDB-style file with coordinates for d6jo5d_.
(The format of our PDB-style files is described here.)

Timeline for d6jo5d_: