Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (6 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [370446] (4 PDB entries) |
Domain d6jo6c_: 6jo6 C: [370479] Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6d_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6z_ automated match to d4kt0c_ complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4 |
PDB Entry: 6jo6 (more details), 2.9 Å
SCOPe Domain Sequences for d6jo6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jo6c_ d.58.1.2 (C:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd flsvrvylgsestrsmglsy
Timeline for d6jo6c_: