Lineage for d6jo6c_ (6jo6 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556029Species Chlamydomonas reinhardtii [TaxId:3055] [370446] (4 PDB entries)
  8. 2556032Domain d6jo6c_: 6jo6 C: [370479]
    Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo67_, d6jo68_, d6jo6a_, d6jo6b_, d6jo6d_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6z_
    automated match to d4kt0c_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo6c_

PDB Entry: 6jo6 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6jo6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo6c_ d.58.1.2 (C:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd
flsvrvylgsestrsmglsy

SCOPe Domain Coordinates for d6jo6c_:

Click to download the PDB-style file with coordinates for d6jo6c_.
(The format of our PDB-style files is described here.)

Timeline for d6jo6c_: