![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) ![]() automatically mapped to Pfam PF02935 |
![]() | Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81424] (49 PDB entries) |
![]() | Domain d6j8ml_: 6j8m L: [370478] Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8mz_ automated match to d1v54l_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 6j8m (more details), 1.9 Å
SCOPe Domain Sequences for d6j8ml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j8ml_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]} hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
Timeline for d6j8ml_:
![]() Domains from other chains: (mouse over for more information) d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_ |