Lineage for d6j8ms_ (6j8m S:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641384Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2641385Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2641386Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries)
  8. 2641445Domain d6j8ms_: 6j8m S: [370473]
    Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_
    automated match to d1v54f_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6j8ms_

PDB Entry: 6j8m (more details), 1.9 Å

PDB Description: low-dose structure of bovine heart cytochrome c oxidase in the fully oxidized state determined using 30 kev x-ray
PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d6j8ms_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j8ms_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d6j8ms_:

Click to download the PDB-style file with coordinates for d6j8ms_.
(The format of our PDB-style files is described here.)

Timeline for d6j8ms_: