SCOPe 2.07: Domain d6jy5c1: 6jy5 C:1-77

Lineage for d6jy5c1 (6jy5 C:1-77)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.15: EutN/CcmL-like [159133] (2 families)
homohexameric unit
Family b.40.15.0: automated matches [327164] (1 protein)
not a true family
Protein automated matches [327165] (2 species)
not a true protein
Species Halothiobacillus neapolitanus [TaxId:927] [370440] (1 PDB entry)
Domain d6jy5c1: 6jy5 C:1-77 [370470]
Other proteins in same PDB: d6jy5b2, d6jy5c2, d6jy5d2
automated match to d2rcfd_

Details for d6jy5c1

PDB Entry: 6jy5 (more details), 2.15 Å

PDB Description: structure of csos4b from halothiobacillus neapolitanus

PDB Compounds: (C:) Unidentified carboxysome polypeptide

SCOPe Domain Sequences for d6jy5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy5c1 b.40.15.0 (C:1-77) automated matches {Halothiobacillus neapolitanus [TaxId: 927]}
mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
vgdfeiltdltiggiid

SCOPe Domain Coordinates for d6jy5c1:

Click to download the PDB-style file with coordinates for d6jy5c1.
(The format of our PDB-style files is described here.)

Timeline for d6jy5c1: