Lineage for d6jy5c1 (6jy5 C:1-77)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791232Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) (S)
    homohexameric unit
  5. 2791322Family b.40.15.0: automated matches [327164] (1 protein)
    not a true family
  6. 2791323Protein automated matches [327165] (2 species)
    not a true protein
  7. 2791324Species Halothiobacillus neapolitanus [TaxId:927] [370440] (1 PDB entry)
  8. 2791327Domain d6jy5c1: 6jy5 C:1-77 [370470]
    Other proteins in same PDB: d6jy5b2, d6jy5c2, d6jy5d2
    automated match to d2rcfd_

Details for d6jy5c1

PDB Entry: 6jy5 (more details), 2.15 Å

PDB Description: structure of csos4b from halothiobacillus neapolitanus
PDB Compounds: (C:) Unidentified carboxysome polypeptide

SCOPe Domain Sequences for d6jy5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jy5c1 b.40.15.0 (C:1-77) automated matches {Halothiobacillus neapolitanus [TaxId: 927]}
mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg
vgdfeiltdltiggiid

SCOPe Domain Coordinates for d6jy5c1:

Click to download the PDB-style file with coordinates for d6jy5c1.
(The format of our PDB-style files is described here.)

Timeline for d6jy5c1: