Lineage for d6jo5e_ (6jo5 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393472Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2393473Protein automated matches [191237] (6 species)
    not a true protein
  7. 2393476Species Chlamydomonas reinhardtii [TaxId:3055] [370429] (4 PDB entries)
  8. 2393480Domain d6jo5e_: 6jo5 E: [370468]
    Other proteins in same PDB: d6jo51_, d6jo53_, d6jo54_, d6jo57_, d6jo58_, d6jo59_, d6jo5a_, d6jo5b_, d6jo5c_, d6jo5d_, d6jo5f_, d6jo5j_, d6jo5z_
    automated match to d4y28e_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo5e_

PDB Entry: 6jo5 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (E:) Photosystem I reaction center subunit IV, chloroplastic

SCOPe Domain Sequences for d6jo5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jo5e_ b.34.4.0 (E:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
gpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyaldevva
a

SCOPe Domain Coordinates for d6jo5e_:

Click to download the PDB-style file with coordinates for d6jo5e_.
(The format of our PDB-style files is described here.)

Timeline for d6jo5e_: