![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) ![]() homohexameric unit |
![]() | Family b.40.15.0: automated matches [327164] (1 protein) not a true family |
![]() | Protein automated matches [327165] (2 species) not a true protein |
![]() | Species Halothiobacillus neapolitanus [TaxId:927] [370440] (1 PDB entry) |
![]() | Domain d6jy5b1: 6jy5 B:1-77 [370465] Other proteins in same PDB: d6jy5b2, d6jy5c2, d6jy5d2 automated match to d2rcfd_ |
PDB Entry: 6jy5 (more details), 2.15 Å
SCOPe Domain Sequences for d6jy5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jy5b1 b.40.15.0 (B:1-77) automated matches {Halothiobacillus neapolitanus [TaxId: 927]} mevmrvrsdliatrripglknislrvmedatgkvsvacdpigvpegcwvftisgsaarfg vgdfeiltdltiggiid
Timeline for d6jy5b1: