Lineage for d6jo6a_ (6jo6 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633152Species Chlamydomonas reinhardtii [TaxId:3055] [370420] (4 PDB entries)
  8. 2633156Domain d6jo6a_: 6jo6 A: [370461]
    Other proteins in same PDB: d6jo61_, d6jo63_, d6jo64_, d6jo67_, d6jo68_, d6jo6c_, d6jo6d_, d6jo6e_, d6jo6f_, d6jo6j_, d6jo6z_
    automated match to d4y28a_
    complexed with bcr, chl, cl0, cla, dgd, lhg, lmg, lut, pqn, sf4

Details for d6jo6a_

PDB Entry: 6jo6 (more details), 2.9 Å

PDB Description: structure of the green algal photosystem i supercomplex with light- harvesting complex i
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d6jo6a_:

Sequence, based on SEQRES records: (download)

>d6jo6a_ f.29.1.1 (A:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
kvkiavdrnpvetsfekwakpghfsrtlskgpntttwiwnlhadahdfdshtsdleeisr
kvfsahfgqlgiifiwlsgmyfhgarfsnyeawlsdpthikpsaqvvwpivgqeilngdv
gggfqgiqitsgffqlwrasgitselqlyttaigglvmaaamffagwfhyhkaapklewf
qnvesmlnhhlggllglgslawaghqihvslpvnklldagvdpkeiplphdlllnraima
dlypsfakgiapfftlnwseysdfltfkgglnpvtgglwlsdtahhhvaiavlflvaghm
yrtnwgighsmkeileahrgpftgeghvglyeilttswhaqlainlalfgslsiivahhm
yamppypylatdygtqlslfthhtwiggfcivgagahaaifmvrdydptnnynnlldrvi
rhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnth
flapqltapnalaatsltwggdlvavggkvammpislgtsdfmvhhihaftihvtvlill
kgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynslsivifhfs
wkmqsdvwgtvtasgvshitggnfaqsantingwlrdflwaqssqviqsygsalsaygli
flgahfvwafslmflfsgrgywqeliesivwahnklkvapaiqpralsitqgravgvahy
llggiattwsfflariisvg

Sequence, based on observed residues (ATOM records): (download)

>d6jo6a_ f.29.1.1 (A:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
kvkiavdrnpvetsfekwakpghfsrtlskgpntttwiwnlhadahdfdshtsdleeisr
kvfsahfgqlgiifiwlsgmyfhgarfsnyeawlsdpthikpsaqvvwpivgqeilngdv
gggfqgiqitsgffqlwrasgitselqlyttaigglvmaaamffagwfhyhkaapklewf
qnvesmlnhhlggllglgslawaghqihvslpvnklldagvdpkeiplphdlllnraima
dlypsfakgiapfftlnwseysdfltfkgglnpvtgglwlsdtahhhvaiavlflvaghm
yrtnwgighsmkeileahrgpftgeghvglyeilttswhaqlainlalfgslsiivahhm
yamppypylatdygtqlslfthhtwiggfcivgagahaaifmvrdydptnnynnlldrvi
rhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnth
flapqltapnalaatsltwggdlvavggkvammpislgtsdfmvhhihaftihvtvlill
kgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynslsivifhfs
wkmqsdvwgtvtgvshitggnfaqsantingwlrdflwaqssqviqsygsalsayglifl
gahfvwafslmflfsgrgywqeliesivwahnklkvapaiqpralsitqgravgvahyll
ggiattwsfflariisvg

SCOPe Domain Coordinates for d6jo6a_:

Click to download the PDB-style file with coordinates for d6jo6a_.
(The format of our PDB-style files is described here.)

Timeline for d6jo6a_: