Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries) |
Domain d6j8mo2: 6j8m O:91-227 [370445] Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_ automated match to d1v54b1 complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 6j8m (more details), 1.9 Å
SCOPe Domain Sequences for d6j8mo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j8mo2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv lelvplkyfekwsasml
Timeline for d6j8mo2:
View in 3D Domains from other chains: (mouse over for more information) d6j8ma_, d6j8mb1, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_ |