SCOPe 2.07: Domain d6j8mo1: 6j8m O:1-90

Lineage for d6j8mo1 (6j8m O:1-90)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)

8. Domain d6j8mo1: 6j8m O:1-90 [370444]
   Other proteins in same PDB: d6j8ma_, d6j8mb2, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo2, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_
   automated match to d1v54b2
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6j8mo1

PDB Entry: 6j8m, 1.9 Å

PDB Description: low-dose structure of bovine heart cytochrome c oxidase in the fully oxidized state determined using 30 kev x-ray

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6j8mo1:

Sequence; same for both SEQRES and ATOM records:

>d6j8mo1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d6j8mo1:

• d6j8mo1 is new in SCOPe 2.07-stable
  
• d6j8mo1 appears in the current release, SCOPe 2.08