Lineage for d1f2aa_ (1f2a A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.1: Papain-like [54002] (15 proteins) 
Protein Cruzain [54020] (1 species) Species Trypanosoma cruzi [TaxId:5693] [54021] (7 PDB entries) 
Domain d1f2aa_: 1f2a A: [37040]
Details for d1f2aa_
PDB Entry: 1f2a (more details), 1.6 Å
PDB Description: crystal structure analysis of cruzain bound to a vinyl sulfone derived inhibitor (ii)
SCOP Domain Sequences for d1f2aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2aa_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg
SCOP Domain Coordinates for d1f2aa_:
Click to download the PDB-style file with coordinates for d1f2aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f2aa_:
- d1f2aa_ appears in SCOP 1.57
- d1f2aa_ appears in the current release, SCOPe 2.08
View in 3D