Lineage for d6jkjb1 (6jkj B:26-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780523Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 2780541Protein SPRY domain-containing SOCS box protein 2 [141159] (2 species)
  7. 2780542Species Human (Homo sapiens) [TaxId:9606] [370338] (1 PDB entry)
  8. 2780544Domain d6jkjb1: 6jkj B:26-220 [370396]
    Other proteins in same PDB: d6jkja2, d6jkjb2
    automated match to d3ek9a_

Details for d6jkjb1

PDB Entry: 6jkj (more details), 1.9 Å

PDB Description: crystal structure of human spsb2 in the apo-state
PDB Compounds: (B:) SPRY domain-containing SOCS box protein 2

SCOPe Domain Sequences for d6jkjb1:

Sequence, based on SEQRES records: (download)

>d6jkjb1 b.29.1.22 (B:26-220) SPRY domain-containing SOCS box protein 2 {Human (Homo sapiens) [TaxId: 9606]}
pegleellsapppdlgaqrrhgwnpkdcsenievkegglyferrpvaqstdgargkrgys
rglhaweiswpleqrgthavvgvatalaplqtdhyaallgsnseswgwdigrgklyhqsk
gpgapqypagtqgeqlevperllvvldmeegtlgyaiggtylgpafrglkgrtlypavsa
vwgqcqvrirylger

Sequence, based on observed residues (ATOM records): (download)

>d6jkjb1 b.29.1.22 (B:26-220) SPRY domain-containing SOCS box protein 2 {Human (Homo sapiens) [TaxId: 9606]}
pegleellsapppdlgaqrrhgwnpkdcsenievkegglyferrpvaqstdgargkrgys
rglhaweiswpleqrgthavvgvatalaplqtdhyaallgsnseswgwdigrgklyhqsk
apqypagtqeqlevperllvvldmeegtlgyaiggtylgpafrglkgrtlypavsavwgq
cqvrirylger

SCOPe Domain Coordinates for d6jkjb1:

Click to download the PDB-style file with coordinates for d6jkjb1.
(The format of our PDB-style files is described here.)

Timeline for d6jkjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6jkjb2