Lineage for d1cb5c_ (1cb5 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2173269Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2173433Protein Bleomycin hydrolase [54017] (2 species)
    DNA-binding protease that has more insertions in the papain-like fold
  7. 2173444Species Human (Homo sapiens) [TaxId:9606] [54019] (2 PDB entries)
  8. 2173449Domain d1cb5c_: 1cb5 C: [37039]

Details for d1cb5c_

PDB Entry: 1cb5 (more details), 2.59 Å

PDB Description: human bleomycin hydrolase.
PDB Compounds: (C:) bleomycin hydrolase

SCOPe Domain Sequences for d1cb5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb5c_ d.3.1.1 (C:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]}
sssglnsekvaaliqklnsdpqfvlaqnvgtthdlldiclkratvqraqhvfqhavpqeg
kpitnqkssgrcwifsclnvmrlpfmkklnieefefsqsylffwdkvercyfflsafvdt
aqrkepedgrlvqfllmnpandggqwdmlvnivekygvipkkcfpesytteatrrmndil
nhkmrefcirlrnlvhsgatkgeisatqdvmmeeifrvvciclgnppetftweyrdkdkn
yqkigpitplefyrehvkplfnmedkiclvndprpqhkhnklytveylsnmvggrktlyn
nqpidflkkmvaasikdgeavwfgcdvgkhfnsklglsdmnlydhelvfgvslknmnkae
rltfgeslmthamtftavsekddqdgaftkwrvenswgedhghkgylcmtdewfseyvye
vvvdrkhvpeevlavleqepiilpawdpmgala

SCOPe Domain Coordinates for d1cb5c_:

Click to download the PDB-style file with coordinates for d1cb5c_.
(The format of our PDB-style files is described here.)

Timeline for d1cb5c_: