Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Bleomycin hydrolase [54017] (2 species) DNA-binding protease that has more insertions in the papain-like fold |
Species Human (Homo sapiens) [TaxId:9606] [54019] (2 PDB entries) |
Domain d1cb5c_: 1cb5 C: [37039] |
PDB Entry: 1cb5 (more details), 2.59 Å
SCOPe Domain Sequences for d1cb5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cb5c_ d.3.1.1 (C:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} sssglnsekvaaliqklnsdpqfvlaqnvgtthdlldiclkratvqraqhvfqhavpqeg kpitnqkssgrcwifsclnvmrlpfmkklnieefefsqsylffwdkvercyfflsafvdt aqrkepedgrlvqfllmnpandggqwdmlvnivekygvipkkcfpesytteatrrmndil nhkmrefcirlrnlvhsgatkgeisatqdvmmeeifrvvciclgnppetftweyrdkdkn yqkigpitplefyrehvkplfnmedkiclvndprpqhkhnklytveylsnmvggrktlyn nqpidflkkmvaasikdgeavwfgcdvgkhfnsklglsdmnlydhelvfgvslknmnkae rltfgeslmthamtftavsekddqdgaftkwrvenswgedhghkgylcmtdewfseyvye vvvdrkhvpeevlavleqepiilpawdpmgala
Timeline for d1cb5c_: