Lineage for d6jega1 (6jeg A:27-152)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969675Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2969786Domain d6jega1: 6jeg A:27-152 [370381]
    automated match to d1d0na1
    complexed with gol; mutant

Details for d6jega1

PDB Entry: 6jeg (more details), 2.98 Å

PDB Description: crystal structure of calcium free human gelsolin amyloid mutant g167r
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d6jega1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jega1 d.109.1.1 (A:27-152) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
vehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva
sgfkhv

SCOPe Domain Coordinates for d6jega1:

Click to download the PDB-style file with coordinates for d6jega1.
(The format of our PDB-style files is described here.)

Timeline for d6jega1: