SCOPe 2.05: Domain d1cb5a_: 1cb5 A:

Lineage for d1cb5a_ (1cb5 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Bleomycin hydrolase [54017] (2 species)
   DNA-binding protease that has more insertions in the papain-like fold

7. Species Human (Homo sapiens) [TaxId:9606] [54019] (2 PDB entries)

8. Domain d1cb5a_: 1cb5 A: [37037]

Details for d1cb5a_

PDB Entry: 1cb5, 2.59 Å

PDB Description: human bleomycin hydrolase.

PDB Compounds: (A:) bleomycin hydrolase

SCOPe Domain Sequences for d1cb5a_:

Sequence; same for both SEQRES and ATOM records:

>d1cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]}
sssglnsekvaaliqklnsdpqfvlaqnvgtthdlldiclkratvqraqhvfqhavpqeg
kpitnqkssgrcwifsclnvmrlpfmkklnieefefsqsylffwdkvercyfflsafvdt
aqrkepedgrlvqfllmnpandggqwdmlvnivekygvipkkcfpesytteatrrmndil
nhkmrefcirlrnlvhsgatkgeisatqdvmmeeifrvvciclgnppetftweyrdkdkn
yqkigpitplefyrehvkplfnmedkiclvndprpqhkhnklytveylsnmvggrktlyn
nqpidflkkmvaasikdgeavwfgcdvgkhfnsklglsdmnlydhelvfgvslknmnkae
rltfgeslmthamtftavsekddqdgaftkwrvenswgedhghkgylcmtdewfseyvye
vvvdrkhvpeevlavleqepiilpawdpmgala

Timeline for d1cb5a_:

• d1cb5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1cb5a_ appears in SCOPe 2.04
  
• d1cb5a_ appears in SCOPe 2.06
  
• d1cb5a_ appears in the current release, SCOPe 2.08