![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) ![]() |
![]() | Family c.34.1.0: automated matches [191535] (1 protein) not a true family |
![]() | Protein automated matches [190910] (10 species) not a true protein |
![]() | Species Streptomyces olivoviridis [TaxId:67338] [370359] (1 PDB entry) |
![]() | Domain d6jlsa_: 6jls A: [370360] automated match to d1g63a_ complexed with fmn |
PDB Entry: 6jls (more details), 2.24 Å
SCOPe Domain Sequences for d6jlsa_:
Sequence, based on SEQRES records: (download)
>d6jlsa_ c.34.1.0 (A:) automated matches {Streptomyces olivoviridis [TaxId: 67338]} gqltltmclsgsvssvagphmaawlssagvgrlhvaltpsaqqfvttnslrpfvngsvlt detvwsaggaphvriaaesdavvvapataatlgklangicdnivtqivmaaecpvilapv mnpamlakpavrrnldalraegfvvaepgqgvnatngrweagsmadfrsvfavalksaae
>d6jlsa_ c.34.1.0 (A:) automated matches {Streptomyces olivoviridis [TaxId: 67338]} gqltltmclsgsvssvagphmaawlssagvgrlhvaltpsaqqfvttnslrpfvngsvlt detvwsaggaphvriaaesdavvvapataatlgklangicdnivtqivmaaecpvilapv mnpamlakpavrrnldalraegfvvaepfrsvfavalksaae
Timeline for d6jlsa_: