Lineage for d6jlsa_ (6jls A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864431Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864432Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2864471Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2864472Protein automated matches [190910] (10 species)
    not a true protein
  7. 2864537Species Streptomyces olivoviridis [TaxId:67338] [370359] (1 PDB entry)
  8. 2864538Domain d6jlsa_: 6jls A: [370360]
    automated match to d1g63a_
    complexed with fmn

Details for d6jlsa_

PDB Entry: 6jls (more details), 2.24 Å

PDB Description: crystal structure of fmn-dependent cysteine decarboxylases tvaf from thioviridamide biosynthesis
PDB Compounds: (A:) Putative flavoprotein decarboxylase

SCOPe Domain Sequences for d6jlsa_:

Sequence, based on SEQRES records: (download)

>d6jlsa_ c.34.1.0 (A:) automated matches {Streptomyces olivoviridis [TaxId: 67338]}
gqltltmclsgsvssvagphmaawlssagvgrlhvaltpsaqqfvttnslrpfvngsvlt
detvwsaggaphvriaaesdavvvapataatlgklangicdnivtqivmaaecpvilapv
mnpamlakpavrrnldalraegfvvaepgqgvnatngrweagsmadfrsvfavalksaae

Sequence, based on observed residues (ATOM records): (download)

>d6jlsa_ c.34.1.0 (A:) automated matches {Streptomyces olivoviridis [TaxId: 67338]}
gqltltmclsgsvssvagphmaawlssagvgrlhvaltpsaqqfvttnslrpfvngsvlt
detvwsaggaphvriaaesdavvvapataatlgklangicdnivtqivmaaecpvilapv
mnpamlakpavrrnldalraegfvvaepfrsvfavalksaae

SCOPe Domain Coordinates for d6jlsa_:

Click to download the PDB-style file with coordinates for d6jlsa_.
(The format of our PDB-style files is described here.)

Timeline for d6jlsa_: