Lineage for d6j8mb2 (6j8m B:91-227)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380835Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2380836Protein Cytochrome c oxidase [49544] (4 species)
  7. 2380837Species Cow (Bos taurus) [TaxId:9913] [49545] (45 PDB entries)
  8. 2380891Domain d6j8mb2: 6j8m B:91-227 [370352]
    Other proteins in same PDB: d6j8ma_, d6j8mb1, d6j8mc_, d6j8md_, d6j8me_, d6j8mf_, d6j8mg_, d6j8mh_, d6j8mi_, d6j8mj_, d6j8mk_, d6j8ml_, d6j8mm_, d6j8mn_, d6j8mo1, d6j8mp_, d6j8mq_, d6j8mr_, d6j8ms_, d6j8mt_, d6j8mu_, d6j8mv_, d6j8mw_, d6j8mx_, d6j8my_, d6j8mz_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6j8mb2

PDB Entry: 6j8m (more details), 1.9 Å

PDB Description: low-dose structure of bovine heart cytochrome c oxidase in the fully oxidized state determined using 30 kev x-ray
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6j8mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j8mb2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d6j8mb2:

Click to download the PDB-style file with coordinates for d6j8mb2.
(The format of our PDB-style files is described here.)

Timeline for d6j8mb2: