SCOPe 2.07: Domain d6j55h1: 6j55 H:1-87

Lineage for d6j55h1 (6j55 H:1-87)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (38 species)
   not a true protein

7. Species Acanthamoeba castellanii [TaxId:5755] [370308] (1 PDB entry)

8. Domain d6j55h1: 6j55 H:1-87 [370313]
   Other proteins in same PDB: d6j55a2, d6j55a3, d6j55b2, d6j55b3, d6j55c2, d6j55c3, d6j55d2, d6j55d3, d6j55e2, d6j55f2, d6j55g2, d6j55h2, d6j55i2, d6j55j2, d6j55k2, d6j55l2, d6j55l3
   automated match to d2awpa1
   complexed with fe2

Details for d6j55h1

PDB Entry: 6j55, 2.33 Å

PDB Description: crystal structure of an iron superoxide dismutate (fesod) from a pathogenic acanthamoeba castellanii

PDB Compounds: (H:) superoxide dismutase

SCOPe Domain Sequences for d6j55h1:

Sequence; same for both SEQRES and ATOM records:

>d6j55h1 a.2.11.0 (H:1-87) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
mlftlndpaylktglepaisaktldfhfnghhktylnktndlvkgtslenksledvilva
kttnnaalfnnatqlwnhsffwdcmap

Timeline for d6j55h1:

• d6j55h1 is new in SCOPe 2.07-stable
  
• d6j55h1 appears in the current release, SCOPe 2.08