Lineage for d6iaoa_ (6iao A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2723142Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2723143Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2723144Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 2723269Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2723302Species Bacillus megaterium [TaxId:1404] [48269] (108 PDB entries)
    Uniprot P14779
  8. 2723464Domain d6iaoa_: 6iao A: [370307]
    Other proteins in same PDB: d6iaoc2
    automated match to d4zf8a_
    complexed with cl, dtt, gol, hem, peg; mutant

Details for d6iaoa_

PDB Entry: 6iao (more details), 2.16 Å

PDB Description: structure of cytochrome p450 bm3 m11 mutant in complex with dtt at resolution 2.16a
PDB Compounds: (A:) Bifunctional cytochrome P450/NADPH--P450 reductase

SCOPe Domain Sequences for d6iaoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iaoa_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapglvtrylssqrlikeac
dgsrfdknlsqalkfvrdiagdglvtswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpgdmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnkqqranpddpacdenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghvttsgllsfalyflvknpyvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlsmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkiplgg

SCOPe Domain Coordinates for d6iaoa_:

Click to download the PDB-style file with coordinates for d6iaoa_.
(The format of our PDB-style files is described here.)

Timeline for d6iaoa_: