SCOPe 2.06: Domain d1cqdd_: 1cqd D:

Lineage for d1cqdd_ (1cqd D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Proline-specific cysteine protease [54013] (1 species)

7. Species Ginger rhizome (Zingiber officinale) [TaxId:94328] [54014] (1 PDB entry)

8. Domain d1cqdd_: 1cqd D: [37030]
   complexed with nag, thj

Details for d1cqdd_

PDB Entry: 1cqd, 2.1 Å

PDB Description: the 2.1 angstrom structure of a cysteine protease with proline specificity from ginger rhizome, zingiber officinale

PDB Compounds: (D:) protein (protease II)

SCOPe Domain Sequences for d1cqdd_:

Sequence; same for both SEQRES and ATOM records:

>d1cqdd_ d.3.1.1 (D:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]}
lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan
hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs
lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns
wgknwgesgyiraernienpdgkcgitrfasypvkk

Timeline for d1cqdd_:

• d1cqdd_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqdd_ appears in SCOPe 2.05
  
• d1cqdd_ appears in SCOPe 2.07
  
• d1cqdd_ appears in the current release, SCOPe 2.08