Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) |
Superfamily d.3.1: Cysteine proteinases [54001] (7 families) |
Family d.3.1.1: Papain-like [54002] (15 proteins) |
Protein Proline-specific cysteine protease [54013] (1 species) |
Species Ginger rhizome (Zingiber officinale) [TaxId:94328] [54014] (1 PDB entry) |
Domain d1cqdd_: 1cqd D: [37030] |
PDB Entry: 1cqd (more details), 2.1 Å
SCOP Domain Sequences for d1cqdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqdd_ d.3.1.1 (D:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale)} lpdsidwrengavvpvknqggcgscwafstvaaveginqivtgdlislseqqlvdcttan hgcrggwmnpafqfivnngginseetypyrgqdgicnstvnapvvsidsyenvpshneqs lqkavanqpvsvtmdaagrdfqlyrsgiftgscnisanhaltvvgygtendkdfwivkns wgknwgesgyiraernienpdgkcgitrfasypvkk
Timeline for d1cqdd_: