Lineage for d6iyso1 (6iys O:27-270)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813016Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2813017Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2813018Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 2813030Protein automated matches [190440] (3 species)
    not a true protein
  7. 2813031Species Borrelia burgdorferi [TaxId:224326] [326377] (12 PDB entries)
  8. 2813043Domain d6iyso1: 6iys O:27-270 [370296]
    Other proteins in same PDB: d6iyso2
    automated match to d3aumo_
    mutant

Details for d6iyso1

PDB Entry: 6iys (more details), 3 Å

PDB Description: loop deletion and proline insertion mutant (deleting six residues and inserted three proline residues)
PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d6iyso1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iyso1 b.76.1.1 (O:27-270) automated matches {Borrelia burgdorferi [TaxId: 224326]}
knsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskv
kltisddlgqttlevfksdgstlvskkvtskdkssteekfnekgevsekiitradgtrle
ytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtpp
pkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitkldeik
nalk

SCOPe Domain Coordinates for d6iyso1:

Click to download the PDB-style file with coordinates for d6iyso1.
(The format of our PDB-style files is described here.)

Timeline for d6iyso1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6iyso2