SCOPe 2.08: Domain d6iyso1: 6iys O:27-270

Lineage for d6iyso1 (6iys O:27-270)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.1: Outer surface protein [51087] (1 family)
   21 stranded sheet partly folded upon itself at the ends

5. Family b.76.1.1: Outer surface protein [51088] (3 proteins)

6. Protein automated matches [190440] (3 species)
   not a true protein

7. Species Borrelia burgdorferi [TaxId:224326] [326377] (12 PDB entries)

8. Domain d6iyso1: 6iys O:27-270 [370296]
   Other proteins in same PDB: d6iyso2
   automated match to d3aumo_
   mutant

Details for d6iyso1

PDB Entry: 6iys, 3 Å

PDB Description: loop deletion and proline insertion mutant (deleting six residues and inserted three proline residues)

PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d6iyso1:

Sequence; same for both SEQRES and ATOM records:

>d6iyso1 b.76.1.1 (O:27-270) automated matches {Borrelia burgdorferi [TaxId: 224326]}
knsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskv
kltisddlgqttlevfksdgstlvskkvtskdkssteekfnekgevsekiitradgtrle
ytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtpp
pkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitkldeik
nalk

Timeline for d6iyso1:

• d6iyso1 first appeared in SCOPe 2.07