Lineage for d6i6cb_ (6i6c B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451094Protein Sepiapterin reductase [51767] (2 species)
  7. 2451095Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries)
    Uniprot P35270 5-261
  8. 2451105Domain d6i6cb_: 6i6c B: [370244]
    Other proteins in same PDB: d6i6ca2
    automated match to d4hwka_
    complexed with edo, h4h, nap

Details for d6i6cb_

PDB Entry: 6i6c (more details), 1.72 Å

PDB Description: sepiapterin reductase in complex with compound 2
PDB Compounds: (B:) sepiapterin reductase

SCOPe Domain Sequences for d6i6cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i6cb_ c.2.1.2 (B:) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
llekdefksgahvdfyd

SCOPe Domain Coordinates for d6i6cb_:

Click to download the PDB-style file with coordinates for d6i6cb_.
(The format of our PDB-style files is described here.)

Timeline for d6i6cb_: