Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Sepiapterin reductase [51767] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries) Uniprot P35270 5-261 |
Domain d6i6cb_: 6i6c B: [370244] Other proteins in same PDB: d6i6ca2 automated match to d4hwka_ complexed with edo, h4h, nap |
PDB Entry: 6i6c (more details), 1.72 Å
SCOPe Domain Sequences for d6i6cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i6cb_ c.2.1.2 (B:) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]} glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls llekdefksgahvdfyd
Timeline for d6i6cb_: