SCOPe 2.08: Domain d6i8xa1: 6i8x A:1-143

Lineage for d6i8xa1 (6i8x A:1-143)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (25 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [370233] (2 PDB entries)

8. Domain d6i8xa1: 6i8x A:1-143 [370241]
   Other proteins in same PDB: d6i8xa2
   automated match to d5bvqa_
   complexed with edo, tam, vca

Details for d6i8xa1

PDB Entry: 6i8x, 2.3 Å

PDB Description: as-p18, an extracellular fatty acid binding protein

PDB Compounds: (A:) Fatty acid-binding protein homolog

SCOPe Domain Sequences for d6i8xa1:

Sequence; same for both SEQRES and ATOM records:

>d6i8xa1 b.60.1.0 (A:1-143) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
ktlpdkflgtfklerdenfdeylkargygwimrqviklagvtkkfrnaasgkpdrydmen
lttkkdthhkdwalgeefqdealdstqhkitfdlkdpntltethikvddptdvetyeyrr
dgdylvmkmswkgvstsryykkq

Timeline for d6i8xa1:

• d6i8xa1 first appeared in SCOPe 2.07