SCOPe 2.07: Domain d6hyja_: 6hyj A:

Lineage for d6hyja_ (6hyj A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein)
   the insertion subdomain is a 4-helical bundle
   automatically mapped to Pfam PF06888
   automatically mapped to Pfam PF12710

6. Protein Phosphoserine phosphatase [64512] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89645] (6 PDB entries)

8. Domain d6hyja_: 6hyj A: [370238]
   automated match to d1l8la_
   complexed with ca, sep, ser

Details for d6hyja_

PDB Entry: 6hyj, 1.93 Å

PDB Description: psph human phosphoserine phosphatase

PDB Compounds: (A:) Phosphoserine Phosphatase

SCOPe Domain Sequences for d6hyja_:

Sequence; same for both SEQRES and ATOM records:

>d6hyja_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
hselrklfysadavcfdvdstvireegidelakicgvedavsemtrramggavpfkaalt
erlaliqpsreqvqrliaeqpphltpgirelvsrlqernvqvflisggfrsivehvaskl
nipatnvfanrlkfyfngeyagfdetqptaesggkgkvikllkekfhfkkiimigdgatd
meacppadafigfggnvirqqvkdnakwyitdfvellgele

Timeline for d6hyja_:

• d6hyja_ is new in SCOPe 2.07-stable
  
• d6hyja_ appears in the current release, SCOPe 2.08