SCOPe 2.08: Domain d1pcib_: 1pci B:

Lineage for d1pcib_ (1pci B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Caricain (protease omega) [54007] (1 species)

7. Species Papaya (Carica papaya) [TaxId:3649] [54008] (3 PDB entries)

8. Domain d1pcib_: 1pci B: [37023]
   zymogen with propeptide
   CASP2
   has additional insertions and/or extensions that are not grouped together

Details for d1pcib_

PDB Entry: 1pci, 3.2 Å

PDB Description: procaricain

PDB Compounds: (B:) procaricain

SCOPe Domain Sequences for d1pcib_:

Sequence; same for both SEQRES and ATOM records:

>d1pcib_ d.3.1.1 (B:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]}
ltsterliqlfnswmlnhnkfyenvdeklyrfeifkdnlnyidetnkknnsywlglnefa
dlsndefnekyvgslidatieqsydeefinedivnlpenvdwrkkgavtpvrhqgscgsc
wafsavatveginkirtgklvelseqelvdcerrshgckggyppyaleyvakngihlrsk
ypykakqgtcrakqvggpivktsgvgrvqpnnegnllnaiakqpvsvvveskgrpfqlyk
ggifegpcgtkvdgavtavgygksggkgyiliknswgtawgekgyirikrapgnspgvcg
lykssyyptkn

Timeline for d1pcib_:

• d1pcib_ first appeared (with stable ids) in SCOP 1.55
  
• d1pcib_ appears in SCOPe 2.07