SCOPe 2.08: Domain d6i6fa1: 6i6f A:1-260

Lineage for d6i6fa1 (6i6f A:1-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Sepiapterin reductase [51767] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141874] (14 PDB entries)
   Uniprot P35270 5-261

8. Domain d6i6fa1: 6i6f A:1-260 [370224]
   Other proteins in same PDB: d6i6fa2
   automated match to d4hwka_
   complexed with edo, h4e, nap

Details for d6i6fa1

PDB Entry: 6i6f, 1.94 Å

PDB Description: sepiapterin reductase in complex with compound 1

PDB Compounds: (A:) sepiapterin reductase

SCOPe Domain Sequences for d6i6fa1:

Sequence, based on SEQRES records:

>d6i6fa1 c.2.1.2 (A:1-260) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
megglgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersg
lrvvrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqv
nnywalnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardml
fqvlaleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqk
llsllekdefksgahvdfyd

Sequence, based on observed residues (ATOM records):

>d6i6fa1 c.2.1.2 (A:1-260) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
megglgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaglrv
vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
llekdefksgahvdfyd

Timeline for d6i6fa1:

• d6i6fa1 first appeared in SCOPe 2.07