Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Amycolatopsis sp. [TaxId:385957] [354294] (24 PDB entries) |
Domain d6hqma_: 6hqm A: [370220] automated match to d3nc5a_ complexed with hem, jz3 |
PDB Entry: 6hqm (more details), 1.85 Å
SCOPe Domain Sequences for d6hqma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hqma_ a.104.1.0 (A:) automated matches {Amycolatopsis sp. [TaxId: 385957]} rpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcrevatspdfea vitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarrylerfen dghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsitnaavdengefanpeg faegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiyptiyvyllg amqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsataristkpvt iagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacagiyfanhv mrialeelfeaipnlerdtregvefwgwgfrgptslhvtwe
Timeline for d6hqma_: