![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Hyperthermus butylicus [TaxId:415426] [370208] (1 PDB entry) |
![]() | Domain d6huna1: 6hun A:9-135 [370209] Other proteins in same PDB: d6huna2 automated match to d3a12d1 complexed with ca |
PDB Entry: 6hun (more details), 1.8 Å
SCOPe Domain Sequences for d6huna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6huna1 d.58.9.0 (A:9-135) automated matches {Hyperthermus butylicus [TaxId: 415426]} siylefvdesykpgkdeviavfrvtpaqgisikdaagriaaessvgtwttlsvkpswfek lkakayrfhdlgdgswlvwvaypvelfeegsipnfassilgnifgmkaiaglrvedvyfp psyletf
Timeline for d6huna1: