Lineage for d6huna1 (6hun A:9-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953113Species Hyperthermus butylicus [TaxId:415426] [370208] (1 PDB entry)
  8. 2953114Domain d6huna1: 6hun A:9-135 [370209]
    Other proteins in same PDB: d6huna2
    automated match to d3a12d1
    complexed with ca

Details for d6huna1

PDB Entry: 6hun (more details), 1.8 Å

PDB Description: dimeric archeal rubisco from hyperthermus butylicus
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d6huna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6huna1 d.58.9.0 (A:9-135) automated matches {Hyperthermus butylicus [TaxId: 415426]}
siylefvdesykpgkdeviavfrvtpaqgisikdaagriaaessvgtwttlsvkpswfek
lkakayrfhdlgdgswlvwvaypvelfeegsipnfassilgnifgmkaiaglrvedvyfp
psyletf

SCOPe Domain Coordinates for d6huna1:

Click to download the PDB-style file with coordinates for d6huna1.
(The format of our PDB-style files is described here.)

Timeline for d6huna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6huna2