![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
![]() | Domain d6hr2d_: 6hr2 D: [370203] Other proteins in same PDB: d6hr2a_, d6hr2b_, d6hr2c1, d6hr2c2, d6hr2e_, d6hr2f_, d6hr2g1, d6hr2g2 automated match to d1lqba_ complexed with dms, edo, fwz |
PDB Entry: 6hr2 (more details), 1.76 Å
SCOPe Domain Sequences for d6hr2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hr2d_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
Timeline for d6hr2d_: