![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Amycolatopsis sp. [TaxId:385957] [354294] (24 PDB entries) |
![]() | Domain d6hqqa_: 6hqq A: [370202] automated match to d3nc5a_ complexed with 3dm, hem |
PDB Entry: 6hqq (more details), 1.66 Å
SCOPe Domain Sequences for d6hqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hqqa_ a.104.1.0 (A:) automated matches {Amycolatopsis sp. [TaxId: 385957]} rpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcrevatspdfea vitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarrylerfen dghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsatnaavdengefanpeg faegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiyptiyvyllg amqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsataristkpvt iagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacagiyfanhv mrialeelfeaipnlerdtregvefwgwgfrgptslhvtwev
Timeline for d6hqqa_: