![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (24 species) not a true protein |
![]() | Species Ochromonas danica [TaxId:2986] [369281] (6 PDB entries) |
![]() | Domain d6i25a1: 6i25 A:181-312 [370197] Other proteins in same PDB: d6i25a2 automated match to d5dklb_ complexed with 5dd, 9o9, cl, mg |
PDB Entry: 6i25 (more details), 1.97 Å
SCOPe Domain Sequences for d6i25a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i25a1 d.110.3.0 (A:181-312) automated matches {Ochromonas danica [TaxId: 2986]} dyslvkalqtaqqnfvisdpsipdnpivyasqgfltltgyalsevlgrncrflqgpetdp kavekvrkglergedttvvllnyrkdgstfwnqlfiaalrdgegnvvnylgvqckvsedy akaflkneenek
Timeline for d6i25a1: