Lineage for d6hrna_ (6hrn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689125Species Nostoc sp. [TaxId:1180] [370150] (1 PDB entry)
  8. 2689126Domain d6hrna_: 6hrn A: [370190]
    automated match to d5toua_
    complexed with cyc, mpd, no3, peg, pg4, pge, po4

Details for d6hrna_

PDB Entry: 6hrn (more details), 1.51 Å

PDB Description: c-phycocyanin from heterocyst forming filamentous cyanobacterium nostoc sp. wr13
PDB Compounds: (A:) Alpha Subunit of Cyanobacterial Phycocyanin protein

SCOPe Domain Sequences for d6hrna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hrna_ a.1.1.3 (A:) automated matches {Nostoc sp. [TaxId: 1180]}
mktplteavatadsqgrflsstelqvafgrfrqatasldaakglsskaqsladgaanavy
qkfpyttqmqgnnfastptgkakcardigyyiriitycliaggtgplddyligglaeinr
tfdlspswyvealkyikanhglsgdpaveansyidyainals

SCOPe Domain Coordinates for d6hrna_:

Click to download the PDB-style file with coordinates for d6hrna_.
(The format of our PDB-style files is described here.)

Timeline for d6hrna_: