Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (23 species) not a true protein |
Species Nostoc sp. [TaxId:1180] [370150] (1 PDB entry) |
Domain d6hrna_: 6hrn A: [370190] automated match to d5toua_ complexed with cyc, mpd, no3, peg, pg4, pge, po4 |
PDB Entry: 6hrn (more details), 1.51 Å
SCOPe Domain Sequences for d6hrna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hrna_ a.1.1.3 (A:) automated matches {Nostoc sp. [TaxId: 1180]} mktplteavatadsqgrflsstelqvafgrfrqatasldaakglsskaqsladgaanavy qkfpyttqmqgnnfastptgkakcardigyyiriitycliaggtgplddyligglaeinr tfdlspswyvealkyikanhglsgdpaveansyidyainals
Timeline for d6hrna_: