SCOPe 2.08: Domain d6i4ka2: 6i4k A:148-375

Lineage for d6i4ka2 (6i4k A:148-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [336601] (11 PDB entries)

8. Domain d6i4ka2: 6i4k A:148-375 [370189]
   Other proteins in same PDB: d6i4ka1, d6i4kg_
   automated match to d3ub5a2
   complexed with atp, bme, btb, ca, cl, peg, scn; mutant

Details for d6i4ka2

PDB Entry: 6i4k, 1.83 Å

PDB Description: crystal structure of plasmodium falciparum actin i (g115a mutant) in the ca-atp state

PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d6i4ka2:

Sequence; same for both SEQRES and ATOM records:

>d6i4ka2 c.55.1.1 (A:148-375) automated matches {Plasmodium falciparum [TaxId: 36329]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydesgpsivhrkc

Timeline for d6i4ka2:

• d6i4ka2 first appeared in SCOPe 2.07