Lineage for d6higl2 (6hig L:107-211)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. Domain d6higl2: 6hig L:107-211 [370181]
    Other proteins in same PDB: d6high_, d6higl1
    automated match to d1dn0a2

Details for d6higl2

PDB Entry: 6hig (more details), 2.2 Å

PDB Description: hpd-1/nbo1a fab complex
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d6higl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6higl2 b.1.1.2 (L:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d6higl2 are not available.

Timeline for d6higl2:

Domains from same chain:
(mouse over for more information)
d6higl1
Domains from other chains:
(mouse over for more information)
d6high_