![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF06888 automatically mapped to Pfam PF12710 |
![]() | Protein Phosphoserine phosphatase [64512] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89645] (6 PDB entries) |
![]() | Domain d6hyjb_: 6hyj B: [370172] automated match to d1l8la_ complexed with ca, sep, ser |
PDB Entry: 6hyj (more details), 1.93 Å
SCOPe Domain Sequences for d6hyjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hyjb_ c.108.1.4 (B:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} mishselrklfysadavcfdvdstvireegidelakicgvedavsemtrramggavpfka alterlaliqpsreqvqrliaeqpphltpgirelvsrlqernvqvflisggfrsivehva sklnipatnvfanrlkfyfngeyagfdetqptaesggkgkvikllkekfhfkkiimigdg atdmeacppadafigfggnvirqqvkdnakwyitdfvellgel
Timeline for d6hyjb_: