Lineage for d6hyjb_ (6hyj B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.4: Phosphoserine phosphatase [64511] (1 protein)
the insertion subdomain is a 4-helical bundle
automatically mapped to Pfam PF06888
automatically mapped to Pfam PF12710Protein Phosphoserine phosphatase [64512] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [89645] (6 PDB entries) 
Domain d6hyjb_: 6hyj B: [370172]
automated match to d1l8la_
complexed with ca, sep, ser
Details for d6hyjb_
PDB Entry: 6hyj (more details), 1.93 Å
PDB Description: psph human phosphoserine phosphatase
PDB Compounds: (B:) Phosphoserine PhosphataseSCOPe Domain Sequences for d6hyjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hyjb_ c.108.1.4 (B:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
mishselrklfysadavcfdvdstvireegidelakicgvedavsemtrramggavpfka
alterlaliqpsreqvqrliaeqpphltpgirelvsrlqernvqvflisggfrsivehva
sklnipatnvfanrlkfyfngeyagfdetqptaesggkgkvikllkekfhfkkiimigdg
atdmeacppadafigfggnvirqqvkdnakwyitdfvellgel
SCOPe Domain Coordinates for d6hyjb_:
Click to download the PDB-style file with coordinates for d6hyjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6hyjb_:
- d6hyjb_ first appeared in SCOPe 2.07
View in 3D
