Lineage for d6hr2a_ (6hr2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2321020Domain d6hr2a_: 6hr2 A: [370171]
    Other proteins in same PDB: d6hr2b_, d6hr2c1, d6hr2c2, d6hr2d_, d6hr2f_, d6hr2g1, d6hr2g2, d6hr2h_
    automated match to d2grca_
    complexed with dms, edo, fwz

Details for d6hr2a_

PDB Entry: 6hr2 (more details), 1.76 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca4 and pvhl:elonginc:elonginb
PDB Compounds: (A:) Transcription activator BRG1

SCOPe Domain Sequences for d6hr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hr2a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvdfkkik
erirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkieked

SCOPe Domain Coordinates for d6hr2a_:

Click to download the PDB-style file with coordinates for d6hr2a_.
(The format of our PDB-style files is described here.)

Timeline for d6hr2a_: