Lineage for d6i4ia1 (6i4i A:6-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885406Species Plasmodium falciparum [TaxId:36329] [225582] (23 PDB entries)
  8. 2885439Domain d6i4ia1: 6i4i A:6-147 [370169]
    Other proteins in same PDB: d6i4ia2, d6i4ig_
    automated match to d2btfa1
    complexed with adp, af3, ca, k, mg, scn; mutant

Details for d6i4ia1

PDB Entry: 6i4i (more details), 1.9 Å

PDB Description: crystal structure of plasmodium falciparum actin i (f54y mutant) in the mg-k-adp-alfn state
PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d6i4ia1:

Sequence, based on SEQRES records: (download)

>d6i4ia1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdayvgdeaqtkrgi
ltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimf
esfnvpamyvaiqavlslyssg

Sequence, based on observed residues (ATOM records): (download)

>d6i4ia1 c.55.1.0 (A:6-147) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqalvvdngsgnvkagvagddaprsvfpsivgrpknpdayvgdeaqtkrgiltlkypieh
givtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvpamy
vaiqavlslyssg

SCOPe Domain Coordinates for d6i4ia1:

Click to download the PDB-style file with coordinates for d6i4ia1.
(The format of our PDB-style files is described here.)

Timeline for d6i4ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6i4ia2
View in 3D
Domains from other chains:
(mouse over for more information)
d6i4ig_