Lineage for d6i4ig_ (6i4i G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969841Protein automated matches [226883] (2 species)
    not a true protein
  7. 2969848Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)
  8. 2969859Domain d6i4ig_: 6i4i G: [370168]
    Other proteins in same PDB: d6i4ia1, d6i4ia2
    automated match to d4cbug_
    complexed with adp, af3, ca, k, mg, scn; mutant

Details for d6i4ig_

PDB Entry: 6i4i (more details), 1.9 Å

PDB Description: crystal structure of plasmodium falciparum actin i (f54y mutant) in the mg-k-adp-alfn state
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d6i4ig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i4ig_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqydlh
ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggva
sgf

SCOPe Domain Coordinates for d6i4ig_:

Click to download the PDB-style file with coordinates for d6i4ig_.
(The format of our PDB-style files is described here.)

Timeline for d6i4ig_: