Lineage for d6hhna1 (6hhn A:2-104)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517142Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2517516Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2517517Protein automated matches [190081] (31 species)
    not a true protein
  7. 3070100Species Formosa agariphila [TaxId:320324] [370162] (1 PDB entry)
  8. 3070101Domain d6hhna1: 6hhn A:2-104 [370163]
    Other proteins in same PDB: d6hhna2
    automated match to d1x8da1

Details for d6hhna1

PDB Entry: 6hhn (more details), 1.47 Å

PDB Description: crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila
PDB Compounds: (A:) L-rhamnose mutarotase

SCOPe Domain Sequences for d6hhna1:

Sequence, based on SEQRES records: (download)

>d6hhna1 d.58.4.0 (A:2-104) automated matches {Formosa agariphila [TaxId: 320324]}
erlafkmklnkgqkqaykerhdqlwpelkqllkdngvseysifideetntlfafqkvsgh
ggsqdlanneivkkwwdfmadimqvnpdnspvsipleevfyme

Sequence, based on observed residues (ATOM records): (download)

>d6hhna1 d.58.4.0 (A:2-104) automated matches {Formosa agariphila [TaxId: 320324]}
erlafkmklnkgqkqaykerhdqlwpelkqllkdngvseysifideetntlfafqkvsgd
lanneivkkwwdfmadimqvnpdnspvsipleevfyme

SCOPe Domain Coordinates for d6hhna1:

Click to download the PDB-style file with coordinates for d6hhna1.
(The format of our PDB-style files is described here.)

Timeline for d6hhna1:

  • d6hhna1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6hhna2