Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
Domain d6hr2e_: 6hr2 E: [370152] Other proteins in same PDB: d6hr2b_, d6hr2c1, d6hr2c2, d6hr2d_, d6hr2f_, d6hr2g1, d6hr2g2, d6hr2h_ automated match to d2grca_ complexed with dms, edo, fwz |
PDB Entry: 6hr2 (more details), 1.76 Å
SCOPe Domain Sequences for d6hr2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hr2e_ a.29.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eklspnppnltkkmkkivdavikykdsssgrqlsevfiqlpsrkelpeyyelirkpvdfk kikerirnhkyrslndlekdvmllcqnaqtfnlegsliyedsivlqsvftsvrqkieked
Timeline for d6hr2e_: