SCOPe 2.08: Domain d6hr2c1: 6hr2 C:17-112

Lineage for d6hr2c1 (6hr2 C:17-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)

8. Domain d6hr2c1: 6hr2 C:17-112 [370145]
   Other proteins in same PDB: d6hr2a_, d6hr2b_, d6hr2c2, d6hr2d_, d6hr2e_, d6hr2f_, d6hr2g2, d6hr2h_
   automated match to d1lm8c_
   complexed with dms, edo, fwz

Details for d6hr2c1

PDB Entry: 6hr2, 1.76 Å

PDB Description: crystal structure of protac 2 in complex with the bromodomain of human smarca4 and pvhl:elonginc:elonginb

PDB Compounds: (C:) Elongin-C

SCOPe Domain Sequences for d6hr2c1:

Sequence, based on SEQRES records:

>d6hr2c1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d6hr2c1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

Timeline for d6hr2c1:

• d6hr2c1 first appeared in SCOPe 2.07