Lineage for d6hpoa_ (6hpo A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561676Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 2561677Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 2561678Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (4 proteins)
  6. 2561724Protein automated matches [191203] (3 species)
    not a true protein
  7. 2561729Species Human (Homo sapiens) [TaxId:9606] [189544] (6 PDB entries)
  8. 3070080Domain d6hpoa_: 6hpo A: [370142]
    automated match to d2toha_
    complexed with fe

Details for d6hpoa_

PDB Entry: 6hpo (more details), 1.67 Å

PDB Description: crystallographic structure of the catalytic domain of human phenylalanine hydroxylase (hpah cd) in complex with iron at 1.6 angstrom
PDB Compounds: (A:) phenylalanine-4-hydroxylase

SCOPe Domain Sequences for d6hpoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hpoa_ d.178.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
rsfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqy
clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
ytqrievldn

SCOPe Domain Coordinates for d6hpoa_:

Click to download the PDB-style file with coordinates for d6hpoa_.
(The format of our PDB-style files is described here.)

Timeline for d6hpoa_:

  • d6hpoa_ is new in SCOPe 2.07-stable