Lineage for d1bqi__ (1bqi -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29566Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 29567Superfamily d.3.1: Cysteine proteinases [54001] (7 families) (S)
  5. 29568Family d.3.1.1: Papain-like [54002] (15 proteins)
  6. 29662Protein Papain [54005] (1 species)
  7. 29663Species Papaya (Carica papaya) [TaxId:3649] [54006] (16 PDB entries)
  8. 29674Domain d1bqi__: 1bqi - [37014]

Details for d1bqi__

PDB Entry: 1bqi (more details), 2.5 Å

PDB Description: use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.

SCOP Domain Sequences for d1bqi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqi__ d.3.1.1 (-) Papain {Papaya (Carica papaya)}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

SCOP Domain Coordinates for d1bqi__:

Click to download the PDB-style file with coordinates for d1bqi__.
(The format of our PDB-style files is described here.)

Timeline for d1bqi__: